PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g24650
Common NameHB1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 273aa    MW: 30280.1 Da    PI: 8.2736
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g24650genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.83.8e-18127181256
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 rk+ ++tk q   Lee F+ +++++ +++++LA++l+L  rqV vWFqNrRa+ k
  CA02g24650 127 RKKLRLTKAQSALLEESFKLHSTLNPKQKQDLAMELSLRPRQVEVWFQNRRARTK 181
                 788899***********************************************98 PP

2HD-ZIP_I/II121.73.6e-39127216191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rl+k q++lLEesF+ +++L+p++K++la eL l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l+een+rL+ke +eL+ +l
   CA02g24650 127 RKKLRLTKAQSALLEESFKLHSTLNPKQKQDLAMELSLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTEENRRLHKELQELK-AL 216
                  69*************************************************************************************9.44 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.99E-18115184IPR009057Homeodomain-like
PROSITE profilePS5007116.989123183IPR001356Homeobox domain
SMARTSM003891.5E-14125187IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.7E-17127181IPR009057Homeodomain-like
CDDcd000861.69E-14127184No hitNo description
PfamPF000461.3E-15127181IPR001356Homeobox domain
PROSITE patternPS000270158181IPR017970Homeobox, conserved site
SMARTSM003401.3E-24183226IPR003106Leucine zipper, homeobox-associated
PfamPF021839.9E-11183217IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MGFDDICNTG LVLGLGFSST TDQKSTKITP LASKGPASLT FEPSLTLSLI SGDRTYEQQA  60
TKKVNVTKPS NDHQSADLYR QDSAASSYSN ASVKRERDVG SEETTTEVER VSSRVISDED  120
DDGSNARKKL RLTKAQSALL EESFKLHSTL NPKQKQDLAM ELSLRPRQVE VWFQNRRART  180
KLKQTEVDCE FLKKCCETLT EENRRLHKEL QELKALKIAQ PLYMQLPAAT LTMCPSCERI  240
GGGVGENPSK NPFTIAQKPH FYSPFNNPSA AC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1175183RRARTKLKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00477DAPTransfer from AT4G37790Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9989720.0EU998972.1 Capsicum annuum homeodomain leucine-zipper 1 (HB1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016560896.10.0PREDICTED: homeobox-leucine zipper protein HAT22
SwissprotP466041e-95HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLC6FFS50.0C6FFS5_CAPAN; Homeodomain leucine-zipper 1
STRINGPGSC0003DMT4000551991e-170(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29024186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.11e-94HD-ZIP family protein